| Sequence 1: | NP_650825.2 | Gene: | CG7432 / 42347 | FlyBaseID: | FBgn0038727 | Length: | 721 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006135.2 | Gene: | GZMA / 3001 | HGNCID: | 4708 | Length: | 262 | Species: | Homo sapiens |
| Alignment Length: | 38 | Identity: | 11/38 - (28%) |
|---|---|---|---|
| Similarity: | 19/38 - (50%) | Gaps: | 7/38 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 SRLAFVLLVSACVMAMAAPKQMVFGFGKRSMADISDMP 42 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7432 | NP_650825.2 | CLIP | 335..378 | CDD:197829 | |
| Tryp_SPc | 475..718 | CDD:238113 | |||
| GZMA | NP_006135.2 | Tryp_SPc | 29..254 | CDD:238113 | 11/38 (29%) |
| Blue background indicates that the domain is not in the aligned region. | |||||