DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and Prss30

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:260 Identity:100/260 - (38%)
Similarity:146/260 - (56%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 GRIVGGVEAPNGQWPWMAAIFLHGPKRTE---FWCGGSLIGTKYILTAAHCTRDSRQKPFAARQF 534
            |:||||.:||.|:|||..::      |||   ..||||||...::||||||.    .:|..:..:
  Rat    29 GKIVGGQDAPEGRWPWQVSL------RTEKEGHICGGSLIHEVWVLTAAHCF----CRPLNSSFY 83

  Fly   535 TVRLGDIDLSTDAEPSDPVTFAVKEVRTHERF----SRIGFYNDIAILVLDKPVRKSKYVIPVCL 595
            .|::|.:.||. .||...:. ||:.:..:..:    :..|   |||:|.||.|::.|:: .||||
  Rat    84 HVKVGGLTLSL-TEPHSTLV-AVRNIFVYPTYLWEDASSG---DIALLRLDTPLQPSQF-SPVCL 142

  Fly   596 PKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYF---------QPI 651
            |:. :.|   ..||....|.|||.|:.....|..|..| :|:..:|||:|.|.         :.|
  Rat   143 PQA-QAP---LTPGTVCWVTGWGATHERELASVLQELA-VPLLDSEDCERMYHIGETSLSGKRVI 202

  Fly   652 NENFICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIR 716
            ..:.:|||:.:|..|:|||||||||:...:|.|:|:|:.|:|..|..|..|||||||.:|:|||:
  Rat   203 QSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQ 267

  Fly   717  716
              Rat   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 97/256 (38%)
Tryp_SPc 475..718 CDD:238113 99/258 (38%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H88826
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.