DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and clec-4

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_496688.1 Gene:clec-4 / 189654 WormBaseID:WBGene00012583 Length:425 Species:Caenorhabditis elegans


Alignment Length:284 Identity:53/284 - (18%)
Similarity:87/284 - (30%) Gaps:106/284 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 AAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQ-KPFAAR--QFTVRLGDIDLSTDAEPSD 551
            |:.:..|.|..|..||.        |.:.|...::|. ..|..|  :..:.||.:      .|:|
 Worm   177 ASTYTKGQKICEQECGN--------LASIHSANENRYIMTFGGRATKEDLLLGGM------WPAD 227

  Fly   552 PV-TFAVKEVRTHERFSRIGFYNDIAILVLD---KPVR---------KSKYVIPVCLPKGIRMPP 603
            .| .:....:..:|.|..|...:.:.:::.:   :|:.         |::|.:....|.||:.||
 Worm   228 DVYNWVDGSLWEYENFDPINVRDSVCVIMSNGDSRPIALGMWYSGECKNEYSVVCKRPAGIQCPP 292

  Fly   604 KERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWR----NEDCDRSYFQP------------IN 652
                   ..|:|                    |:..    ...|:.|...|            .|
 Worm   293 -------NPTIV--------------------PVTPMPAVQSFCNSSVMAPSEITSPHFPYNYYN 330

  Fly   653 ENFICAGYSDGG-------------------VDACQGDS-GGPLMMRYDSHWVQLGVVSFGNKC- 696
            .:|.....|..|                   |....||| ..|::..|...:....|:|.|||. 
 Worm   331 SDFCSYQISTLGSYNVLLRFSTFDTEKVNDVVTVYDGDSTNDPVIGVYAGSFYPFTVISTGNKML 395

  Fly   697 ---------GEPGYPGVYTRVTEY 711
                     ...|:.|   |:|.|
 Worm   396 VTFKTDKSNTRQGFSG---RITSY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 53/284 (19%)
Tryp_SPc 475..718 CDD:238113 53/284 (19%)
clec-4NP_496688.1 CLECT 27..153 CDD:214480
CLECT 162..283 CDD:214480 22/119 (18%)
CUB 309..415 CDD:238001 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6818
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.