DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7432 and try-3

DIOPT Version :9

Sequence 1:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:274 Identity:78/274 - (28%)
Similarity:128/274 - (46%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 RIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRL 538
            ||:||....:|. .|||.:..:|.......||.::|...:::|||||....:.:.|.    .|| 
 Worm    37 RIIGGNSIDDGA-NWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFV----YVR- 95

  Fly   539 GDIDLSTDAEPSD--PVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRM 601
                     ||.:  ..:|:|||...|..::.....||||:|.:...:.|.. :.||||   :..
 Worm    96 ---------EPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLG-IKPVCL---VHD 147

  Fly   602 PPKERLPGRRATVVGWGTTYYGGKESTSQ---------RQAELPIWRNEDCDRSY---------- 647
            ..|.....:...|:|:|.|.  |::|:.:         :...:||..::||.:::          
 Worm   148 DSKLLKQYKNGVVIGYGLTL--GEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKI 210

  Fly   648 --FQPINENFICAG-YSDGGVDACQGDSGGPLMM-RYDSHWVQLGVVSFGNKCGEPG------YP 702
              :|      |||| |..|   ...|||||||:: :.:..:||:|:.|:|.. |..|      :|
 Worm   211 TGYQ------ICAGAYLHG---TAPGDSGGPLLIHKSNGEYVQIGITSYGAD-GLDGVIDQGKFP 265

  Fly   703 GVYTRVTEYLDWIR 716
            |||||:::|:.||:
 Worm   266 GVYTRISKYVPWIQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 76/271 (28%)
Tryp_SPc 475..718 CDD:238113 77/273 (28%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 76/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.