DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6184 and Fam234a

DIOPT Version :10

Sequence 1:NP_732443.4 Gene:CG6184 / 42345 FlyBaseID:FBgn0038725 Length:1029 Species:Drosophila melanogaster
Sequence 2:NP_997100.1 Gene:Fam234a / 106581 MGIID:2146854 Length:555 Species:Mus musculus


Alignment Length:121 Identity:29/121 - (23%)
Similarity:47/121 - (38%) Gaps:27/121 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ECCVLSTSP--GCRRAAS---------FPFVGDSSIIQASSLKVRSKSESEALNKMRLT---QMN 58
            ||.|:..:|  |.|.|.|         ||..||   :..:|:......:...:.:..|.   ::|
Mouse   149 ECLVVRVTPDLGERIAVSGDKSLIEEIFPETGD---VMCNSVNAGWNQDPTHVIRFPLNGYCRLN 210

  Fly    59 LETVRKRLSE---STIKEKDEGSDYQSHSSSSSECEVDDLELFCA---GPLELKEE 108
            ...|.:||.:   |.:.....|.|    ||..||..:...:..|.   .|:.:|:|
Mouse   211 SVQVLERLFQKGFSMVASCGGGVD----SSQFSEYILSREDRRCQTSHTPIRIKQE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6184NP_732443.4 PQQ <263..>328 CDD:441129
FG-GAP_3 460..518 CDD:433275
Fam234aNP_997100.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
PQQ <137..>206 CDD:441129 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.