DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG34409

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:294 Identity:91/294 - (30%)
Similarity:132/294 - (44%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 STEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGI 140
            :|:.||.::.: |::||.:|....:||:..:.|.|.::..|...|:||||::.:::|:||||..:
  Fly   238 NTQGCGINVES-RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNL 301

  Fly   141 PRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIAL 205
            ..||.|..||||..|                 .|.|   ..:|::|||..:......|   ||||
  Fly   302 VSDLELSHVRLGSQD-----------------GATP---FAIEQVIVHPNYDQPKYAN---DIAL 343

  Fly   206 LRLKMPVRYRTGIMPICIPKHGFFAKSKLEI------AGW--GKT--NEGQFSQVLMHG--FIRE 258
            ||:...   .....|||:|.:|........|      |||  |.|  |..........|  |||.
  Fly   344 LRINST---NGTFTPICLPFNGPITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRL 405

  Fly   259 RSIAVCALRFPYLDLNQSLQ---------ICAGGYDGVDTCQGDSGGPLMVTMDN--SSVY---- 308
            ..:...:....|..|:::.|         :||.|....|.|:||||||.   ||:  |.|:    
  Fly   406 PIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPF---MDDGTSGVFGTSG 467

  Fly   309 ---LAGITTYGSKNCGQIGIPGIYTRTSAFLPWI 339
               :.||..:|...||...|||:||..|:|..||
  Fly   468 RYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 86/280 (31%)
Tryp_SPc 90..342 CDD:238113 87/280 (31%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 86/280 (31%)
Tryp_SPc 252..501 CDD:238113 85/277 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.