DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG34171

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:302 Identity:71/302 - (23%)
Similarity:113/302 - (37%) Gaps:109/302 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 MAMLLYLNTTTLEI-------------------------LP----FCAGSLINNRYVLTSAHCV- 137
            :|::|..|.||::|                         .|    ||.|.::.||:|||||||: 
  Fly    11 IALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSAHCIT 75

  Fly   138 --NGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCA----LPNLE---IKLEKIIVHGLFSS 193
              ||:.  :|.|.:.:.                   .||    .|..|   :.:..:|:|..:  
  Fly    76 DKNGVM--MSPKRIVVA-------------------LCASLFKTPESEEFVVDIHNMIIHPYY-- 117

  Fly   194 ISNRNIEYDIALLRLKMPVRYRTG--IMPICIPKHGFFAKSKLEIAGWGKTNEGQF--------- 247
              :||...|||:::||..|:. .|  :.|:.:      ..|.||:....||..|.|         
  Fly   118 --HRNQHNDIAIIKLKRYVKL-DGHHLAPVVL------GNSSLEVGNDCKTIGGIFGVRRQRFGS 173

  Fly   248 --SQVLMHGFIRERSIAVCALRFPYLDLNQSLQ---------ICAGGYDGVDTCQGDSGGPLMVT 301
              |.:|::  :..|....|      |.:.:||.         ||....: ...|..|.||||.. 
  Fly   174 FHSMLLVN--VELRPFDEC------LKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFC- 228

  Fly   302 MDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343
              :..:|  || ..||.||.... |..::..|.:..|:..::
  Fly   229 --DGQLY--GI-ALGSINCSSPD-PVFFSDVSFYNSWVTKII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 70/296 (24%)
Tryp_SPc 90..342 CDD:238113 71/299 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 64/278 (23%)
Tryp_SPc 38..263 CDD:304450 65/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.