DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:121/284 - (42%) Gaps:52/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLT 132
            |.|..:|..|.:....:.. |:..|..|.....|::..||:......    :|.||:|.|.:|||
  Fly    18 PTPEQKLVPTPVKDVKIQG-RITNGYPAYEGKVPYIVGLLFSGNGNW----WCGGSIIGNTWVLT 77

  Fly   133 SAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLE--IKLEKIIVHGLFSSIS 195
            :|||.|             |...:|.:  |....|:|      |...  :.....:.|..::|  
  Fly    78 AAHCTN-------------GASGVTIN--YGASLRNQ------PQYTHWVGSGNFVQHHHYNS-- 119

  Fly   196 NRNIEYDIALLRLKMPVRYRTGIMPICIPKH--------GFFAKSKLEIAGWGKTNEGQ-FSQVL 251
             .|:..||:|:|.. .|.:...:..:.:|.:        |::|.:    :|||.|.:|. ....|
  Fly   120 -GNLHNDISLIRTP-HVDFWHLVNKVELPSYNDRYQDYAGWWAVA----SGWGGTYDGSPLPDWL 178

  Fly   252 MHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYG 316
            ....::..|.:.|:..:   .|:.:: ||.....|..||.|||||||:....|.   |.|:|::.
  Fly   179 QAVDVQIMSQSDCSRSW---SLHDNM-ICINTNGGKSTCGGDSGGPLVTHEGNR---LVGVTSFV 236

  Fly   317 SKNCGQIGIPGIYTRTSAFLPWIK 340
            |....|.|.|.:::|.:.:|.||:
  Fly   237 SSAGCQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 66/261 (25%)
Tryp_SPc 90..342 CDD:238113 67/262 (26%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 66/261 (25%)
Tryp_SPc 38..262 CDD:238113 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.