DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG9733

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:278 Identity:105/278 - (37%)
Similarity:147/278 - (52%) Gaps:14/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVN 138
            ||....||......|:..|.:...|.:|||.:|.|...:...:...|||||||.|||||:|||:.
  Fly   147 LPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLT 211

  Fly   139 G-IPRDL-SLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEY 201
            | |.|:: :|.|||||||    |.....||......|:.....:..|:|.||..:|..::..: :
  Fly   212 GRIEREVGTLVSVRLGEH----DTRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQV-H 271

  Fly   202 DIALLRLKMPVRYRTGIMPICIPKH-GFFAK---SKLEIAGWGKTNEGQFSQVLMHGFIRERSIA 262
            ||.|:|::..|||...|.|||:|.. |..::   .:..:||||:|.:...|.|.....:.....|
  Fly   272 DIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARSAVKQKVTVNYVDPA 336

  Fly   263 VCALRFPYLDLN-QSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIP 326
            .|..||..:.:| :..|:||||....|:|.||||||||...|.|.| |.||.::|.| ||....|
  Fly   337 KCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWV-LEGIVSFGYK-CGLKDWP 399

  Fly   327 GIYTRTSAFLPWIKAVLR 344
            |:||..:|:..||:..:|
  Fly   400 GVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 98/257 (38%)
Tryp_SPc 90..342 CDD:238113 99/258 (38%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 98/257 (38%)
Tryp_SPc 162..415 CDD:238113 99/259 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.