DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG11841

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:280 Identity:89/280 - (31%)
Similarity:127/280 - (45%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGE 153
            :|.|:.|.|..:|:.|.|.:..|.. ||..||.|:||:||.|||:|||......::::  |||||
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNN-EIKWFCGGTLISNRLVLTAAHCFFSEHGEVNV--VRLGE 133

  Fly   154 HDITYDPAYNPDCRDQDNQCALPN----LEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRY 214
            .:.           |.|...|.|.    |.:|     .|..|   .|..:..||.:::|...|::
  Fly   134 LEF-----------DTDTDDAEPEDFGVLALK-----AHPGF---ENPQLYNDIGIVQLDREVKF 179

  Fly   215 RTGIMPICIP-----KHGFFAKSKLEIA-GWGKTNEGQ-----FSQVLMHGFIRERSIAVCALRF 268
            .....|.|:|     :|..|      || |||:....|     ..:|.:.|: ::|.::      
  Fly   180 NRYKHPACLPFDDGEQHESF------IAIGWGQKKFAQKESKKLLKVQLQGY-KDRCVS------ 231

  Fly   269 PYLDLNQSL--------QICAGGYDGVDTCQGDSGGPLMV-TMDNSSVY-LAGITTYGSKNCGQI 323
             .:|.|..|        |:|.|..|..|||.||||||::. ..|.:.:| :.|||:.|. .|...
  Fly   232 -SVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGI-TCSTP 294

  Fly   324 GIPGIYTRTSAFLPWIKAVL 343
            .||..|||...||.|||..|
  Fly   295 DIPSAYTRVHYFLNWIKGEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 85/274 (31%)
Tryp_SPc 90..342 CDD:238113 88/276 (32%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 86/275 (31%)
Tryp_SPc 72..310 CDD:214473 85/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.