DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG4815

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:290 Identity:65/290 - (22%)
Similarity:111/290 - (38%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NGYPWMAMLLYLNT------------------------TTLEILP------------FCAGSLIN 126
            :|:..:.:||.||:                        ||:|.|.            .|:.:|:.
  Fly     3 SGWTLVRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLT 67

  Fly   127 NRYVLTSAHCVNGIPRD----LSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIV 187
            .|::||:|||...:.|.    :..||.....|...::                   :.||.::.:
  Fly    68 PRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFN-------------------KNKLIRVQI 113

  Fly   188 HGLFSSISNRNIEYDIALLRLKMPVRYR-TGIMPICIPKHGFFAKSKLEIAGWGKTNEGQFSQVL 251
            |..::.:   ....|:|:.:.|.|:|.: .|...:|  :.....:.||..||||  .||......
  Fly   114 HPKYAKM---KFIADVAVAKTKYPLRSKYIGYAQLC--RSVLHPRDKLIAAGWG--FEGGVWDES 171

  Fly   252 MHGFIRERSIAVCALRFPYLDLNQSLQ---ICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGIT 313
            .....|...:.:.:.|.....|::.:.   ||||.|:....|.|||||||::...     :.||.
  Fly   172 RKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQ-----VCGIN 231

  Fly   314 TYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343
            |:..| ||....|.:|.....:..:||..:
  Fly   232 TWTFK-CGNNEKPDVYMGVRYYAKFIKRTI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 63/284 (22%)
Tryp_SPc 90..342 CDD:238113 65/287 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 56/241 (23%)
Trypsin 49..256 CDD:278516 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436615
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.