DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG16710

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:377 Identity:149/377 - (39%)
Similarity:198/377 - (52%) Gaps:54/377 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFISCIPFALVVVFIQ----LAHSTNSDCYPGEKYVYLYEC--------PHVYTAGRSRTLMREY 53
            :|:..:..:.:|:..|    ||.|....|...||.:.|..|        ||..|.......    
  Fly     2 VFLQRVYISFLVLHTQLLMYLAESEYPPCNLDEKCISLARCTSLLPFLKPHNMTPAEKAVF---- 62

  Fly    54 DMDAWLLFGQR---------ICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYL 109
             .|.:..:|.:         ||||..|:.||:|:|||..:..||:.||.|.:||..||||::||.
  Fly    63 -EDRYCGYGPKGQELLDRVLICCPNMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYA 126

  Fly   110 NTT----TLEILPFCAGSLINNRYVLTSAHC--VNGIPRDLSLKSVRLGEHDITYDPAYNPDCRD 168
            :.:    ...::..||||||.||||||:|||  :.|    |.|:.||||||:|    ..||||..
  Fly   127 HRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITG----LDLRRVRLGEHNI----LSNPDCVT 183

  Fly   169 QDN---QCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIP-----K 225
            ..|   .||..:|||.::..|.|..:.....|... ||||||||.||||...|.|||:.     .
  Fly   184 HINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYN-DIALLRLKFPVRYTAQIKPICVQLDYIFS 247

  Fly   226 HGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTC 290
            :..|:..||:|||||.:::..:|.||:..::..|:...|:|..|.|.|::...||||...|.|||
  Fly   248 NPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTC 312

  Fly   291 QGDSGGPLMVTM---DNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWI 339
            :||||||||..|   |...|||||||:||...|| .| |..||:||.|:.||
  Fly   313 KGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCG-YG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 119/267 (45%)
Tryp_SPc 90..342 CDD:238113 120/267 (45%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 9/53 (17%)
Tryp_SPc 105..362 CDD:214473 119/267 (45%)
Tryp_SPc 106..362 CDD:238113 118/266 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463195
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.