DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG31199

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:134 Identity:43/134 - (32%)
Similarity:66/134 - (49%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ARPNGYPWMAMLLYLNTTTLEILP-FCAGSLINNRYVLTSAHC---VNGIPRDLSLKSVRLGEHD 155
            |.|..:.|:|.::|......:|.. .|.|.|::.|.||..|||   .||:....   ||.||.|:
  Fly    45 AIPTEHQWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAF---SVHLGVHN 106

  Fly   156 ITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMP 220
            .: .|.....| :.|..|..|:.||||.:|.:|..:.|   |.::..:|:|.|:...:....:||
  Fly   107 KS-APVGVRVC-ETDGYCVRPSQEIKLAEIAIHPDYDS---RTLKNSLAVLTLQRDAKIYPNVMP 166

  Fly   221 ICIP 224
            ||:|
  Fly   167 ICMP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 43/134 (32%)
Tryp_SPc 90..342 CDD:238113 43/134 (32%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 43/134 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.