DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG5246

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:333 Identity:74/333 - (22%)
Similarity:132/333 - (39%) Gaps:99/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VYLYECPHVYTAGRSRTLMREYDMDAWLLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEAR 96
            |.|.:|     :.:|..:.|.:.::..|           |:..|.|          |::||.:: 
  Fly    11 VILSQC-----SAKSVKIHRRHQLNHHL-----------GHVKPET----------RVIGGVDS- 48

  Fly    97 PNGY-PWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDP 160
            |.|: |:...:  :||....:   |.||:|..:::||:|||:     :..::.:::....:.|  
  Fly    49 PTGFAPYQVSI--MNTFGEHV---CGGSIIAPQWILTAAHCM-----EWPIQYLKIVTGTVDY-- 101

  Fly   161 AYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPK 225
                         ..|..|..::...:|......:..|   ||||:....|:.|.....||.:..
  Fly   102 -------------TRPGAEYLVDGSKIHCSHDKPAYHN---DIALIHTAKPIVYDDLTQPIKLAS 150

  Fly   226 HGFFAK--SKLEIAGWGKTNE-GQFSQVLMHGFIRERSIAVCALRFPYLDLN-------QSL--- 277
            .|...|  .||.:.|||.|.. |::|..|..                 :|||       ||.   
  Fly   151 KGSLPKVGDKLTLTGWGSTKTWGRYSTQLQK-----------------IDLNYIDHDNCQSRVRN 198

  Fly   278 -------QICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAF 335
                   .:|....:|..:|.|||||||:    :::..|.|:..:| :.|. ||.|.::...:.:
  Fly   199 ANWLSEGHVCTFTQEGEGSCHGDSGGPLV----DANQTLVGVVNWG-EACA-IGYPDVFGSVAYY 257

  Fly   336 LPWIKAVL 343
            ..||:.::
  Fly   258 HDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 63/271 (23%)
Tryp_SPc 90..342 CDD:238113 64/272 (24%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/271 (23%)
Tryp_SPc 42..263 CDD:238113 64/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.