DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG4053

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:123/297 - (41%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 WLLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAG 122
            |||..........|.||.:     :.|...|:|||.||.....|:...:..:..|.:     |:|
  Fly     9 WLLLLGTSIDVTRGKRLDN-----RKLLDNRIVGGQEAEDGVAPYQVSIQTIWKTHI-----CSG 63

  Fly   123 SLINNRYVLTSAHCVNGIPRDLSLKSVRL--GEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKI 185
            .::|.:::||:.||.    .|.|::.:|:  |.:|           |.:..|...|      ::.
  Fly    64 VILNEQWILTAGHCA----LDFSIEDLRIIVGTND-----------RLEPGQTLFP------DEA 107

  Fly   186 IVHGLFSSISNRNIEY----DIALLRLKMPVRY--RTGIMPIC--IPKHGFFAKSKLEIAGWGKT 242
            :||.|:      :|.|    ||||:.:...:.:  ||.|:.:.  .|..|    |.:.:.|||..
  Fly   108 LVHCLY------DIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAG----STVTLTGWGAP 162

  Fly   243 NEG----QFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMD 303
            ...    |:.|.|....|....   |..|:.:.|......||....:|...|.||||||||    
  Fly   163 ESSYPTVQYLQTLNLTIIAHEE---CRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLM---- 220

  Fly   304 NSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
             ....|.|:..:| :.|| :|:|.:|..|..:..||:
  Fly   221 -WEGKLVGLVNWG-RACG-VGMPDMYANTVYYQDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 69/264 (26%)
Tryp_SPc 90..342 CDD:238113 70/265 (26%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/264 (26%)
Tryp_SPc 35..256 CDD:238113 70/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.