DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG13318

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:340 Identity:98/340 - (28%)
Similarity:145/340 - (42%) Gaps:95/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PHVYTAGRSRTLMREYDMDAWLLFGQRICC------------PPPGNRLPSTEICGQSLSTYRMV 90
            |.|.|.  |.||...|.:.|        ||            ||||:   :|...||        
  Fly   125 PTVPTT--SSTLTCSYGLVA--------CCQAGSYQCGRRFPPPPGS---TTAAPGQ-------- 168

  Fly    91 GGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHD 155
                |....|||.|.||    ||.::. ...|:||..::|||:||.|..:  .|:...|||||.|
  Fly   169 ----ASFGAYPWQAALL----TTADVY-LGGGALITAQHVLTAAHKVYNL--GLTYFKVRLGEWD 222

  Fly   156 I--TYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRY--RT 216
            .  |.:|              :|..::.:..:.|:   .|.:..|::.|:|:|:|..||..  ::
  Fly   223 AASTSEP--------------IPAQDVYISNVYVN---PSFNPNNLQNDVAILKLSTPVSLTSKS 270

  Fly   217 GIMPICIPKHGFFAKSKLEIAGWGKTN---EGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQ 278
            .:..:|:|...|..: :..:|||||.:   .|.:..:       ||.:.|..:  |..:...:||
  Fly   271 TVGTVCLPTTSFVGQ-RCWVAGWGKNDFGATGAYQAI-------ERQVDVPLI--PNANCQAALQ 325

  Fly   279 ---------------ICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGI 328
                           |||||..|.|.|.||.|.||:.| .|...|:.|:..:|. .|.|.|:||:
  Fly   326 ATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCT-SNGVWYVVGLVAWGI-GCAQAGVPGV 388

  Fly   329 YTRTSAFLPWIKAVL 343
            |.....:||||:..|
  Fly   389 YVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 78/272 (29%)
Tryp_SPc 90..342 CDD:238113 80/273 (29%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 80/268 (30%)
Tryp_SPc 169..399 CDD:214473 78/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.