DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Jon74E

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:313 Identity:80/313 - (25%)
Similarity:127/313 - (40%) Gaps:89/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGS 123
            |:.|:.|.|...|:.:..           |:.||..||.|.:|:...|......  ::..:|..|
  Fly    13 LVQGRSISCLDMGHGIGG-----------RIAGGELARANQFPYQVGLSIEEPN--DMYCWCGAS 64

  Fly   124 LINNRYVLTSAHCV----------NGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNL 178
            ||::||:||:||||          .|:.|....:.:|....::...|.:|         |     
  Fly    65 LISDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQLIRSTNPEVHLHPDWN---------C----- 115

  Fly   179 EIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIP----KHGFFAKSKLEIAGW 239
                              :::|.||||:||.........|.||.:|    ....:.......:||
  Fly   116 ------------------QSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGW 162

  Fly   240 GKTNEGQFSQVLMHGFIRERSIAVC-ALRFPY--LDLNQSLQ----------ICAGGYDGVDTCQ 291
            |:.|              :.|.|:. .||:.|  ::.|:..:          ||.....|..||.
  Fly   163 GRMN--------------DESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCT 213

  Fly   292 GDSGGPLMVT--MDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAV 342
            |||||||:.:  :.|:.: |.|:|:||.|:....|.|.::||.:|:|.||..|
  Fly   214 GDSGGPLVYSDPVQNADI-LIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 72/279 (26%)
Tryp_SPc 90..342 CDD:238113 73/280 (26%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 72/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.