DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG11529

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:121/256 - (47%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VGGSE-ARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGE 153
            ||.|: .|...:|:..||:........||  |.|:|::.|::||:.||..|:..    ..|.||.
  Fly    30 VGQSKYGRIEKFPYQVMLIGKQLWRKRIL--CGGTLLDKRWILTAGHCTMGVTH----YDVYLGT 88

  Fly   154 HDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGI 218
            ..:            :|.:.: ..|.::..|.|||..|:..:..|   ||||::|...|.:...|
  Fly    89 KSV------------EDTEVS-GGLVLRSNKFIVHERFNPETAAN---DIALVKLPQDVAFTPRI 137

  Fly   219 MPICIP---KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQIC 280
            .|..:|   :|..||...:..:|||...|...|..:.:..::..|.|.||..:   |:..|..||
  Fly   138 QPASLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVISNAECAQEY---DVVTSGVIC 199

  Fly   281 AGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKA 341
            |.|......|.|||||||::   ..:..:.|||::|..:..:..|||.:||.:.:|.||::
  Fly   200 AKGLKDETVCTGDSGGPLVL---KDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIES 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 74/252 (29%)
Tryp_SPc 90..342 CDD:238113 76/256 (30%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/249 (29%)
Tryp_SPc 37..255 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.