DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG18179

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:291 Identity:77/291 - (26%)
Similarity:120/291 - (41%) Gaps:59/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ICCPPPGNR---LPSTEICGQSLSTYRMVGGSEAR-PNGY-------PWMAMLLYLNTTTLEILP 118
            :...|..||   ||...|.          .|:|.| .|||       |::..|| :.|.......
  Fly    15 VAASPGFNRTSLLPQVTIS----------EGAEGRIVNGYPAPEGKAPYIVGLL-IRTDGSNSAA 68

  Fly   119 FCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLE 183
            ..||::|.:.::||:|||:.     .....:..|. :..::.|:....| :||..:.||      
  Fly    69 VGAGTIIASDWILTAAHCLT-----TDYVEIHYGS-NWGWNGAFRQSVR-RDNFISHPN------ 120

  Fly   184 KIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIP----KHGFFAKSKLEIAGWGKTNE 244
                   :.:...|    ||.|:|.. .|.:...|..:.:|    :...|..:.....|||..:.
  Fly   121 -------WPAEGGR----DIGLIRTP-SVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDN 173

  Fly   245 GQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYL 309
            |..:..|....::..|.:.|...:..:   .|..:|....||..:|.||||||| ||.||:.  |
  Fly   174 GNLADWLQCMDVQIISNSECEQSYGTV---ASTDMCTRRTDGKSSCGGDSGGPL-VTHDNAR--L 232

  Fly   310 AGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
            .|:.|:||.:| ..| |..|||.:.:|.||:
  Fly   233 VGVITFGSVDC-HSG-PSGYTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 69/262 (26%)
Tryp_SPc 90..342 CDD:238113 71/263 (27%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 67/254 (26%)
Tryp_SPc 40..263 CDD:238113 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.