DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG33460

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:120/289 - (41%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LSTYRMVGGSEARPNGY-----------------PWMAMLLYLNTTTLEILPFCAGSLINNRYVL 131
            |::|.:|..|::....|                 ||.|:|    .|...|  ||||:||.:.::|
  Fly    10 LASYMLVIYSDSVSANYLYEQCGLMREEFSTSLGPWTALL----HTDGSI--FCAGTLITDVFIL 68

  Fly   132 TSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHG--LFSSI 194
            |:|.|:    |..::| |||||..                  ..|| |:. |..:||.  ::...
  Fly    69 TAASCI----RPNAVK-VRLGEFG------------------RYPN-ELP-EDHLVHYFLMYRLF 108

  Fly   195 SNRNIEYDIALLRLKMPVRYRTGIMPICI---PKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFI 256
            :|.::..:|.||:|...|:....|||:||   |::...:..:.....|.:.:....::.|....|
  Fly   109 NNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVI 173

  Fly   257 RERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYL-------AGITT 314
            :.:. .:|.      :|:...|.|||....:.:|.|.:|..|:    .:|.|:       .||.|
  Fly   174 QSKP-KMCT------NLDLYTQFCAGHQGNLRSCDGLTGSALI----QNSRYMNKYRHIQFGIAT 227

  Fly   315 YGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343
            ....:|.:  ..| ||....|..||:.|:
  Fly   228 VNDMDCEE--SQG-YTDVLKFYWWIQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 67/279 (24%)
Tryp_SPc 90..342 CDD:238113 69/280 (25%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 66/252 (26%)
Tryp_SPc 44..249 CDD:214473 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.