DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG33465

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:108/255 - (42%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPD 165
            ||||. :|.|...:     |.|:|::..:|||:|.|::   :|..| .|..|        .||  
  Fly    46 PWMAS-IYKNNQFI-----CDGTLVHKLFVLTAASCIS---KDSQL-YVLFG--------MYN-- 90

  Fly   166 CRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI-----PK 225
             :.:|......|.:..:...:.|..|...:..|   ||.||||...|.:...|.||||     .|
  Fly    91 -QYRDASQFFNNEQYGVAVALQHSNFRPNNGVN---DIGLLRLYGEVTHYAHIRPICIILDHVVK 151

  Fly   226 HGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTC 290
            ...|  .:.|..||.:......|||....::.::....|......|.:|:. |.|||..|. ..|
  Fly   152 SAPF--ERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEG-QFCAGNRDR-SFC 212

  Fly   291 QGDSGGPLMVTMD------NSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344
            :.:||.||  |.|      |.:|.: |:.:|||:.|..   ..:||...||..||...:|
  Fly   213 RSNSGSPL--TADFTYGVKNITVQV-GLVSYGSELCSP---TSVYTDVVAFKDWIYNTVR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 71/248 (29%)
Tryp_SPc 90..342 CDD:238113 73/251 (29%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 73/251 (29%)
Tryp_SPc 46..261 CDD:214473 71/248 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.