DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and sphinx2

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:111/280 - (39%) Gaps:63/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV--NGIP 141
            :|.::..:.|:.||..|:|....::..::|.. :.|..|.|.||::|:|:::||....:  ..|.
  Fly    16 VCEKNKLSPRITGGYRAKPYTIIYLVGIVYAK-SPLSSLKFGAGTIISNQWILTVKEVLIFKYIE 79

  Fly   142 RDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYD---- 202
            .....|....| :||                     |.|..|....|            ||    
  Fly    80 AHFGSKRAFWG-YDI---------------------LRIYRENFYFH------------YDKTRI 110

  Fly   203 IALLRLKMPV-RYRTGIMPICIPKHGF----FAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIA 262
            |||  :|.|. ::...:..:.:|.:|.    :..:...:.|||....    :|.:..::|...:.
  Fly   111 IAL--VKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKR----KVRLPTWMRCVEVE 169

  Fly   263 V-----CALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQ 322
            |     ||   .|....:..::|..|......|:||.|| .:|||..:..:: ||......|| .
  Fly   170 VMNNTECA---KYHTPLKWYEMCTSGEGFKGVCEGDMGG-AVVTMGPNPTFI-GIIWLMPTNC-S 228

  Fly   323 IGIPGIYTRTSAFLPWIKAV 342
            ||.|.::.|.|..:.|||.|
  Fly   229 IGYPSVHIRVSDHIKWIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 61/266 (23%)
Tryp_SPc 90..342 CDD:238113 63/267 (24%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 61/266 (23%)
Tryp_SPc 26..248 CDD:304450 63/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.