DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:63/283 - (22%)
Similarity:110/283 - (38%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTS 133
            |.||::..           |:..|..|.....|::..|.:.|......  :|.||:|.:.:|||:
  Fly    28 PAGNKING-----------RITNGYPAYEGKVPYIVALRFDNGNGGGW--YCGGSIIGHEWVLTA 79

  Fly   134 AHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRN 198
            |||..|    .|..::           :|....|.|..                   |:.....|
  Fly    80 AHCTYG----ASYVTI-----------SYGAVWRQQPQ-------------------FTHYDTGN 110

  Fly   199 IEYDIALLRLKMPVRYRTGIMPICIPK--------HGFFAKSKLEIAGWGKTNEGQFSQVLMHGF 255
            :..||||:|.. .|.:.:.:..:.:|:        :|::|.    ::|||.:::.......::..
  Fly   111 LHNDIALIRTP-HVDFWSLVNKVELPRYDDRYNNFYGWWAL----LSGWGSSSDSSGMTDYLNCV 170

  Fly   256 ---IRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGS 317
               |.:.|:.:......|:..|   .:|....:...:|.|||||||::...|..|   ||.::||
  Fly   171 DIQISDNSVCLDYYGSHYITSN---HLCYATPENKGSCSGDSGGPLVLHDGNRQV---GIVSFGS 229

  Fly   318 KNCGQIGIPGIYTRTSAFLPWIK 340
            ........|...||.:.:|.||:
  Fly   230 AAGCLSNSPKGLTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 58/261 (22%)
Tryp_SPc 90..342 CDD:238113 59/262 (23%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 58/261 (22%)
Tryp_SPc 37..254 CDD:238113 59/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.