DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:115/279 - (41%) Gaps:75/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152
            |:.|||.|....:|:. :.|.|..:.|. ..:|.||||.:.:|||:|||.:|:    ...:|.||
  Fly    37 RITGGSNAAVGQFPYQ-VGLSLKLSALS-SAWCGGSLIGSTWVLTAAHCTDGV----QSVTVYLG 95

  Fly   153 -----EHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPV 212
                 ..:||:                    .:....||:|..::|.:.||   ||:|  :|:|.
  Fly    96 ATVRTSAEITH--------------------TVSSSDIIIHSGWNSANLRN---DISL--IKIPA 135

  Fly   213 -----RYRTGIMPICIPKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLD 272
                 |.....:|.....:..|.......:|||:|::               :.:..|....|:|
  Fly   136 TSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSD---------------TSSGVATNLQYVD 185

  Fly   273 LN----------------QSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCG 321
            |.                ....:|....|...||.|||||||::...:..:   |:|::|:....
  Fly   186 LTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI---GLTSFGASAGC 247

  Fly   322 QIGIPGIYTRTSAFLPWIK 340
            :.|.|..:||.:::|.|||
  Fly   248 EKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 67/276 (24%)
Tryp_SPc 90..342 CDD:238113 69/277 (25%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 67/276 (24%)
Tryp_SPc 38..268 CDD:238113 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.