DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG1299

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:369 Identity:113/369 - (30%)
Similarity:165/369 - (44%) Gaps:86/369 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DCYPGEKYVYLYECPHVYTAGRSRTLMREYDMDAWLL------------FGQRICC--------- 67
            |..|| ..|.:.||..:....|||:      .||...            .|.::||         
  Fly   168 DTKPG-NCVEIKECASLLNELRSRS------QDATFANFLRASNAVCQNKGTQVCCPTGQGITNT 225

  Fly    68 -PPPGNRLPST------------EICGQSLSTY-RMVGGSEARPNGYPWMAMLLYLNTTTLEILP 118
             |.|...:|..            |.||.::..: ::|||..:|...:||:|:|.|.:.:.   .|
  Fly   226 TPAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSG---SP 287

  Fly   119 F-CAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKL 182
            | |.|:||..|:|||:|||:.   :||..  |||||||::.|....             :::|.:
  Fly   288 FKCGGTLITARHVLTAAHCIR---QDLQF--VRLGEHDLSTDTETG-------------HVDINI 334

  Fly   183 EKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE------IAGWGK 241
            .:.:.|   ...:.||...|:|:|.|:..|.:.:.|.|||:| |....:.|..      :|||||
  Fly   335 ARYVSH---PDYNRRNGRSDMAILYLERNVEFTSKIAPICLP-HTANLRQKSYVGYMPFVAGWGK 395

  Fly   242 TNE-GQFSQVLMHGFIRERSIAVCALRFP----YLDLNQ--SLQICAGGYD-GVDTCQGDSGGPL 298
            |.| |:.:|||....|......||...:.    |...:|  ...:|||... |.|||||||||||
  Fly   396 TMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPL 460

  Fly   299 MVT---MDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWI 339
            |:.   ......||.|:.:||. .|.:..:||:|:.|..|:.||
  Fly   461 MLPEPYQGQLRFYLIGVVSYGI-GCARPNVPGVYSSTQYFMDWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 91/268 (34%)
Tryp_SPc 90..342 CDD:238113 93/268 (35%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 12/54 (22%)
Tryp_SPc 260..503 CDD:214473 91/268 (34%)
Tryp_SPc 261..503 CDD:238113 91/267 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.