DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG15873

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:189 Identity:47/189 - (24%)
Similarity:84/189 - (44%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FCAGSLINNRYVLTSAHCV-NGIPRDLSLKSVRLGEHDIT----YDPAYNPDCRDQDNQCALPNL 178
            ||:|.|:::|.|||:|||: :.....::.:.:|:....||    ||.:   |.|..|        
  Fly    68 FCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES---DFRSVD-------- 121

  Fly   179 EIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRT-GIMPICIPKHGFFAKSKLEIA-GWGK 241
                 :::||..:    .|..:.|:|:|||...|:... .::|:.:.|..........|. |||:
  Fly   122 -----RLVVHPEY----ERYKKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQ 177

  Fly   242 T-NEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLM 299
            . ..|.:|..|::..:..|..::|...:.....:.:  :|.........|.||.||||:
  Fly   178 IYQHGPYSNELVYLDVILRPPSLCQKHYDTFTADHN--VCTEPVGESMNCAGDMGGPLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 47/189 (25%)
Tryp_SPc 90..342 CDD:238113 47/189 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 47/189 (25%)
Tryp_SPc 59..250 CDD:238113 47/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.