DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG13527

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:99/243 - (40%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FCAGSLINNRYVLTSAHCVNGIPRDLS----LKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLE 179
            :|.|.|::|::|:|:||||.|..:.:.    |..|....|.:.|.|.        .:.|: |...
  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPG--------KSVCS-PVSS 116

  Fly   180 IKLEK-IIVHGLFSSISNRNIEYDIALLRL--KMPVR-YRTGI--MPICIPKHGFFAKSKLEIAG 238
            :.:.| ..:|..|          ::||::|  |||.. .|.|.  :|...||.|.    :..:.|
  Fly   117 LYVPKNFTMHNTF----------NMALMKLQEKMPSNDPRIGFLHLPKEAPKIGI----RHTVLG 167

  Fly   239 WGKTNEG--------QFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYD---GVDTCQG 292
            ||:...|        |...|||..       |||...|.:..   ...:|||..:   ..:.|.|
  Fly   168 WGRMYFGGPLAVHIYQVDVVLMDN-------AVCKTYFRHYG---DGMMCAGNNNWTIDAEPCSG 222

  Fly   293 DSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
            |.|.||:     |...:.||..| ...||...||.:||...:.|.||:
  Fly   223 DIGSPLL-----SGKVVVGIVAY-PIGCGCTNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 65/240 (27%)
Tryp_SPc 90..342 CDD:238113 67/243 (28%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 67/243 (28%)
Tryp_SPc 43..263 CDD:214473 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.