DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and try-9

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:239 Identity:52/239 - (21%)
Similarity:93/239 - (38%) Gaps:64/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDC-----------RD 168
            |.:....|:|::..:::|:||.:.                 |:.||.  |||           ||
 Worm    23 EFVQHGTGTLVSPWHIVTAAHLIG-----------------ISEDPL--PDCDTGNLREAYFVRD 68

  Fly   169 QDN-------QCALPNL------EIKLEKIIVHGLF-------SSISNRNIEYDIALLRLKMPVR 213
            ..|       .||:|.:      :...:.:.:..|:       ....:|....|||:..|:.|:.
 Worm    69 YKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIE 133

  Fly   214 YRTGIMPICI---PKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRE--RSIAVCALRFPYLDL 273
            :...|.|.|:   ||.....::..::.|:|:...   ..||..|.::.  ..:|.|:..|||..:
 Worm   134 FSKDIFPACLPSAPKIPRIRETGYKLFGYGRDPS---DSVLESGKLKSLYSFVAECSDDFPYGGV 195

  Fly   274 NQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV-YLAGITTYG 316
                 .|....:...:|.||||..::.|.|..:| .|.|:.:.|
 Worm   196 -----YCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 52/239 (22%)
Tryp_SPc 90..342 CDD:238113 52/239 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 51/232 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.