DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and scaf

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:115/277 - (41%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CCPPPGNRLP----STEICGQSLSTYRMVGGSEARPN--GYPWMAMLLYLNTTTLEILPFCAGSL 124
            ||..|....|    ...:|.......:..|..:...|  ..||.||:|..::.||    .|.|::
  Fly   394 CCRDPNYVDPWPVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTL----ICGGAI 454

  Fly   125 INNRYVLTSAHCVNGIP-RDLSLKSVRLGEHDI--TYDPAYNPDCRDQDNQCALPNLEIKLEKII 186
            |.:::||:||.||||:| .|:.:|:   ||.::  |.:|              ||.....::.:.
  Fly   455 IGDQFVLSSASCVNGLPVTDIRVKA---GEWELGSTNEP--------------LPFQLTGVKTVD 502

  Fly   187 VHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLEIAGWGKT-----NEGQ 246
            ||..:...:|   .:|:|::||:..:.:.:.|.||||.........:...:||||.     .|| 
  Fly   503 VHPDYDPSTN---SHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQALSIHEEG- 563

  Fly   247 FSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGV------DTCQGDSGGPLMVTMDNS 305
               .|||  :.:             .|.|:...|:.....|      |:||.|.|..| .....|
  Fly   564 ---ALMH--VTD-------------TLPQARSECSADSSSVCSATKFDSCQFDVGSAL-ACGSGS 609

  Fly   306 SVYLAGITTYGSKNCGQ 322
            ||.|.||.. |..:||:
  Fly   610 SVRLKGIFA-GENSCGE 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 69/251 (27%)
Tryp_SPc 90..342 CDD:238113 69/249 (28%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 63/231 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.