DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and F25E5.7

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_872235.1 Gene:F25E5.7 / 353443 WormBaseID:WBGene00017788 Length:379 Species:Caenorhabditis elegans


Alignment Length:288 Identity:60/288 - (20%)
Similarity:100/288 - (34%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 STEICG----QSLSTY---------RMVGGSEARPNGYPW--MAMLLYL---NTTTLEILPFCAG 122
            |:.|.|    |.|.:|         |::.|........||  .|...|.   :.....::....|
 Worm    16 SSRIIGEKENQVLQSYCGRTPFLQRRIINGKPLEAFENPWAVAAQFQYYVQKDGKPKRLVMVFPG 80

  Fly   123 SLINNRYVLT--SAHCVNGI-----PRDLSLKSVRLGEH-----------DITYDPA-YNPDCRD 168
            ::|:..::||  .....:|:     ..:::.....||||           ||..|.: ::...:.
 Worm    81 TVISPYHILTYNLVRSYDGVFGFQHKENMTSNGTCLGEHYFLPEEYTDRFDIIMDRSKFDMTRKF 145

  Fly   169 QDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHG--FFAK 231
            ||         :....|:::|.....|.:     :.:|.||.|:.....|.|:||....  |...
 Worm   146 QD---------LVRRVIVINGCPDVNSAK-----VLILELKKPLELNPSIWPVCISNDPQLFDRS 196

  Fly   232 SKLEIAG---WGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVD-TCQG 292
            |...::|   .|..|.|.|..|            .|::..|:        .||...|... .|..
 Worm   197 SDFSVSGIDAKGVLNSGLFKPV------------NCSVEGPF--------SCAEAVDNKQRMCAY 241

  Fly   293 DSGGPLMVTMDNSSVYLAGITTYGSKNC 320
            ||||..:..:...:..| |:...|:.||
 Worm   242 DSGGSAISNVSGQNTVL-GVYVTGNMNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 54/263 (21%)
Tryp_SPc 90..342 CDD:238113 53/261 (20%)
F25E5.7NP_872235.1 DUF316 2..297 CDD:252150 60/288 (21%)
Tryp_SPc 42..260 CDD:304450 49/252 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.