DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG9377

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:368 Identity:96/368 - (26%)
Similarity:158/368 - (42%) Gaps:96/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CYPGEKYVYLYE-CPH------VYTAGRSRTLMRE--YDMDAWLLFGQRICCPPPGNRLPSTEIC 80
            |.| ||:...|| |..      .:...||||.:.|  :.|:.        ||..| ::||:.:|.
  Fly    25 CGP-EKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEK--------CCNIP-DKLPTPKIP 79

  Fly    81 GQSLSTYRMVGGSE-----ARPNGY----------PWMAMLLYLNTTTLEILPFCAGSLINNRYV 130
            .:.:|.  ..||..     .||.||          ||: :.:|.:.|.|     |:|:||....|
  Fly    80 EEMMSC--PCGGRHDLWYYLRPLGYKQQEAKFGEFPWL-VAVYGSDTYL-----CSGALITPLAV 136

  Fly   131 LTSAHCVNGIPRDLSLKSVRL--GEHD--ITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLF 191
            :|:||||    ::..::.|||  ||.|  :..:|.              |:.:..:.:.:||..:
  Fly   137 ITTAHCV----QNSEMEKVRLLAGEWDAAVELEPQ--------------PHQQRSVVETLVHPNY 183

  Fly   192 SSISNRNIEYDIALLRL--KMPVRYRTGIMPICI-PKHGFFAKSKLEIAGWGKTNEGQFS----- 248
            :.:.   :.::||:|.:  :.|.:....:.|||: |....:..|:..::||.:::.|:.:     
  Fly   184 TQMP---LAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYVSGWQRSDFGRAAILPKR 245

  Fly   249 ---QVLMHGFIRERSIAVCALRFPYLDL----NQSLQICAGGYDGVDTCQGD---SGGPLMVTMD 303
               .||.....|.:      ||...|..    |.|| :||||..|...| ||   :..|||..:.
  Fly   246 WTLYVLPPDQCRTK------LRLSLLGRRHAHNDSL-LCAGGDKGDFVC-GDVDMTAVPLMCPLS 302

  Fly   304 --NSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344
              :...:|||:.|..:: |....:.||||....:..||...||
  Fly   303 GHDDRFHLAGLLTRTAR-CDGPQLLGIYTNVKLYRQWIDLKLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 72/289 (25%)
Tryp_SPc 90..342 CDD:238113 74/290 (26%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 67/270 (25%)
Tryp_SPc 105..339 CDD:214473 66/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.