DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:248 Identity:62/248 - (25%)
Similarity:90/248 - (36%) Gaps:83/248 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLE 183
            :|.||:|.:.:|||:.||:.    |.:...|..|                     |......:..
  Fly    61 WCGGSIIAHDWVLTAEHCIG----DAASVIVYFG---------------------ATWRTNAQFT 100

  Fly   184 KIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFF-AKSKLEI----------- 236
            ..:.:|.|...||.    ||||:|               ||...|: ..:|:|:           
  Fly   101 HTVGNGNFIKHSNA----DIALIR---------------IPHVDFWHMVNKVELPSYNDRYNNYN 146

  Fly   237 ------AGWGKTNEGQ--------FSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGV 287
                  .|||.|.:|.        ....::|.       ..|.  :.|..:..:: ||....||.
  Fly   147 EWWAVACGWGGTYDGSPLPDWLQCVDLQIVHN-------EECG--WTYGSVGDNV-ICTRTVDGK 201

  Fly   288 DTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
            ..|.||||||| ||.|.|.  |.|::.:.|.|..|.|.|..:.|.:..|.||:
  Fly   202 SICGGDSGGPL-VTHDGSK--LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 60/245 (24%)
Tryp_SPc 90..342 CDD:238113 62/248 (25%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 60/245 (24%)
Tryp_SPc 37..253 CDD:238113 62/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.