DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Hayan

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:314 Identity:93/314 - (29%)
Similarity:136/314 - (43%) Gaps:79/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PGNRLPSTEIC------GQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNR 128
            |....||...|      |:.| |..::.|.......||.||.:.|.:..:....  |.||||.:|
  Fly   361 PEKERPSVAACEKIRSGGKPL-TVHILDGERVDRGVYPHMAAIAYNSFGSAAFR--CGGSLIASR 422

  Fly   129 YVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSS 193
            :|||:|||||.  .|.:...||||..:|.     ||:...||         |.:..:.:|..:|.
  Fly   423 FVLTAAHCVNS--DDSTPSFVRLGALNIE-----NPEPGYQD---------INVIDVQIHPDYSG 471

  Fly   194 ISNRNIEYDIALLRLKMPVRYRTGIMPICI------PKHGFFAKSKLEIAGWGKTNEGQFSQVLM 252
            .|.   .||||:|:|....:....|.|.|:      |.    |..|..:||||..|         
  Fly   472 SSK---YYDIAILQLAEDAKESDVIRPACLYTDRSDPP----ANYKYFVAGWGVMN--------- 520

  Fly   253 HGFIRERSIAVCALRFPYLDL----------------NQSL-------QICAGGYD-GVDTCQGD 293
               :..|:::...|| ..|||                |::|       |:||...: ..|.||||
  Fly   521 ---VTNRAVSKILLR-AALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGD 581

  Fly   294 SGGPLMVTMD--NSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLRP 345
            |||||::.:|  :.:..:.|:.:.|. .|. ...||:|||.|:||.:|:.::.|
  Fly   582 SGGPLILEIDDVDGTYSIVGVISSGF-GCA-TKTPGLYTRVSSFLDYIEGIVWP 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 84/282 (30%)
Tryp_SPc 90..342 CDD:238113 85/283 (30%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 84/282 (30%)
Tryp_SPc 385..630 CDD:238113 85/284 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.