DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG31220

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:360 Identity:147/360 - (40%)
Similarity:188/360 - (52%) Gaps:62/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CYPGEKYVYLYEC-PHVYTAGRSR-----------TLM------------REYDMDAWLLFGQRI 65
            |.|.|:.:.|.:| |..|...|:|           |.|            |.|           |
  Fly    27 CEPDEECIRLKDCRPIYYNVRRNRLSGSAKVNISQTRMCGVSVRDRKRYKRIY-----------I 80

  Fly    66 CCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTL----EILPFCAGSLIN 126
            |||.|.|.|||...||:..:|.|::||:|...|.|||:|||||.|.:..    |::|.|.|||||
  Fly    81 CCPKPANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLIN 145

  Fly   127 NRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDC--RDQDNQCALPNLEIKLEKIIVHG 189
            .|||||:||||....  |.::.||||||    ..::||||  |.....||..:|:|.:|.|..|.
  Fly   146 TRYVLTAAHCVTDTV--LQIQRVRLGEH----TTSHNPDCISRGARIVCAPTHLDIDVESITSHN 204

  Fly   190 LFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI---PKHGFFAKSKLEIAGWGKTNEGQF---S 248
            .:.. :|.....||||:|||.||||.....|||:   |:.  ..|.|:.:||||||  |.|   |
  Fly   205 DYDP-ANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRS--LMKFKMYVAGWGKT--GMFDTGS 264

  Fly   249 QVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNS---SVYLA 310
            :||.|..::.|....|:.::.:.......||||||.|...||.||||.|||.|...|   ..:||
  Fly   265 KVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLA 329

  Fly   311 GITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLRP 345
            |||:||.. ||.||.|.::|||:.|..||:|.|||
  Fly   330 GITSYGGP-CGTIGWPSVFTRTAKFYKWIRAHLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 116/265 (44%)
Tryp_SPc 90..342 CDD:238113 117/266 (44%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 116/265 (44%)
Tryp_SPc 104..360 CDD:238113 117/267 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463185
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.