DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG31269

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:107/277 - (38%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCV 137
            |:......|:.....|::||..|.....|:...|..::..     ..|.|::||..:|||:||||
  Fly    22 RIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGA-----HSCGGAIINETFVLTAAHCV 81

  Fly   138 NG--IPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIE 200
            ..  ||..:.          :|....||.           |.....|:.|.:|   .:..|..:.
  Fly    82 ENAFIPWLVV----------VTGTNKYNQ-----------PGGRYFLKAIHIH---CNYDNPEMH 122

  Fly   201 YDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLEIAGWGKTNEGQFS----QVLMHGFIRERSI 261
            .|||||.|..|:.:.....||.:|........::.:.|||.|.....|    |||...::..|..
  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC 187

  Fly   262 AVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIP 326
            ..........|:.   .||.....|...|.|||||||:     |:.||.|:..:|.. |. .|:|
  Fly   188 KALLSNDEDCDVG---HICTFSRLGEGACHGDSGGPLV-----SNGYLVGLVNWGWP-CA-TGVP 242

  Fly   327 GIYTRTSAFLPWIKAVL 343
            .::.....:..||:.|:
  Fly   243 DVHASVYFYRDWIRNVM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 66/256 (26%)
Tryp_SPc 90..342 CDD:238113 67/257 (26%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/256 (26%)
Tryp_SPc 38..258 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.