DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and spirit

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:391 Identity:112/391 - (28%)
Similarity:167/391 - (42%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CIP----FALVVVFIQL--AHST--------NSDCYPGEKYVYLYECPHVYTAGRSRTLMREYD- 54
            |||    ..|::|.:.|  .|:|        ....:|.|.:   .||.....|....|..|..| 
  Fly     8 CIPTRVYLHLLLVSLPLLAVHATPAISPQSLRGIIFPVETF---DECQLEDVARTKGTCRRMEDC 69

  Fly    55 ---MDAWL------------LFGQRICCPP---PGNRLPSTEICGQ--SLSTYR--------MVG 91
               ::.||            .|...:||.|   |.....|.:.|.:  .:|..:        :||
  Fly    70 PSALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVG 134

  Fly    92 GSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHC--VNGIPRDLSLKSVRLGEH 154
            |...||..:|:||.|.:.:.....|...|.|:||.|.:|||:|||  :.|.|.    ..||||  
  Fly   135 GMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPP----SQVRLG-- 193

  Fly   155 DITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIM 219
                          .||.......:|.:.::|:|..:|:.:..|   |||||.|:...  :..:.
  Fly   194 --------------GDNLTLTEGEDISIRRVIIHPDYSASTAYN---DIALLELETAA--KPELK 239

  Fly   220 PICIPKHGFFAKSKLEIAGWGKTN-EGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL---QIC 280
            |.||........:.:...|:|:|: .|..|..|:...::..|...|...:....|.|.:   |:|
  Fly   240 PTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMC 304

  Fly   281 AGGYDGV-DTCQGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344
            ||...|. |||||||||||:: .|....|:.|||:.| :.|.. |.|.:|||.|:|:.||:.::.
  Fly   305 AGDITGERDTCQGDSGGPLLM-QDGLLGYVVGITSLG-QGCAS-GPPSVYTRVSSFVDWIEGIVW 366

  Fly   345 P 345
            |
  Fly   367 P 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 83/265 (31%)
Tryp_SPc 90..342 CDD:238113 85/258 (33%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/46 (20%)
Tryp_SPc 132..364 CDD:238113 85/259 (33%)
Tryp_SPc 132..361 CDD:214473 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.