DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG32260

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:295 Identity:105/295 - (35%)
Similarity:154/295 - (52%) Gaps:53/295 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PPPGNRLPSTEICGQSLST-YRMVGGSEARPNGYPWMAMLLYLNTTTLEILPF-CAGSLINNRYV 130
            |||.|....:..||.|.:| .|:|||.|||...|||:|.|.|........|.| |.||||::|||
  Fly   306 PPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYV 370

  Fly   131 LTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLF--SS 193
            :|||||:|.:     |..||||.||:: .||.:            ..:::::.:.:||..|  :|
  Fly   371 ITSAHCINPM-----LTLVRLGAHDLS-QPAES------------GAMDLRIRRTVVHEHFDLNS 417

  Fly   194 ISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE-----IAGWGKT-NEGQFSQVLM 252
            |||     ||||:.|.:.......|.|||:|:...|.:....     :||||.. ::|..|||| 
  Fly   418 ISN-----DIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVL- 476

  Fly   253 HGFIRERSIAVCALR---------FPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV- 307
                |:..:.:.:..         |.::..:..: :|||. ..||.||||||||||:.....:| 
  Fly   477 ----RDAQVPIVSRHSCEQSYKSIFQFVQFSDKV-LCAGS-SSVDACQGDSGGPLMMPQLEGNVY 535

  Fly   308 --YLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
              ||.|:.::|.: |.:...||:|||.::::||||
  Fly   536 RFYLLGLVSFGYE-CARPNFPGVYTRVASYVPWIK 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 94/271 (35%)
Tryp_SPc 90..342 CDD:238113 96/272 (35%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 94/271 (35%)
Tryp_SPc 328..571 CDD:238113 96/273 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.