DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG11664

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:224 Identity:66/224 - (29%)
Similarity:94/224 - (41%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 AGSLINNRYVLTSAHCV--NGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLE 183
            ||||.:.|||||.|||.  |..|.:|   |||.|...|.::        .:..|.|         
  Fly    48 AGSLFSARYVLTVAHCFKKNTKPEEL---SVRAGYRWIAWE--------FRGKQVA--------- 92

  Fly   184 KIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGI--MPIC---IPKHGFFAKSKLEIAGWGKTN 243
            .::.|..||.::.||   |||:||:|..:.:...|  :.:|   :.....||..: |:|||.   
  Fly    93 GLLRHPKFSPLTLRN---DIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQ-ELAGWN--- 150

  Fly   244 EGQFSQVLMHGFIRERSIAV-------CALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVT 301
                   |||.....:|::|       |...||.:   ....|||....|...|.||||.||:  
  Fly   151 -------LMHIAQPLKSMSVQVEPEKNCRQWFPQI---SGGVICASATMGEGLCYGDSGDPLI-- 203

  Fly   302 MDNSSVYLAGITTYGSKNCGQIGIPGIYT 330
               |...:.|: ....:.||....|.::|
  Fly   204 ---SGGEVCGL-AIAFRKCGDKRYPALFT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 66/224 (29%)
Tryp_SPc 90..342 CDD:238113 66/224 (29%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 66/224 (29%)
Tryp_SPc 38..237 CDD:214473 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.