DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and F10

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:319 Identity:96/319 - (30%)
Similarity:148/319 - (46%) Gaps:82/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PPPGNRLPSTEIC------------------GQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTL 114
            |.|.:.:|..:|.                  ..|....|:|||.|.:....||.|:|.    :..
  Rat   193 PDPEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKRGECPWQALLF----SDE 253

  Fly   115 EILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLE 179
            |...||.|:::|..|:||:|||::...|    ..||:|:        .|.:..|..      .:.
  Rat   254 ETDGFCGGTILNEFYILTAAHCLHQAKR----FKVRVGD--------LNTEQEDGG------EMV 300

  Fly   180 IKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE------IAG 238
            .:::.||.|..|   .....::|||:||||.|:.:|..:.|.|:|:.. :|::.|.      ::|
  Rat   301 HEVDMIIKHNKF---QRDTYDFDIAMLRLKTPITFRENVAPACLPQKD-WAEATLMTQKTGIVSG 361

  Fly   239 WGKTNE-GQFSQVLMHGFIRERSIAVCALRFPYLD-----LNQSLQI-----CAGGYDG--VDTC 290
            :|:|:| |:.|:||.            .:..||:|     |:.|..|     || |||.  .|.|
  Rat   362 FGRTHEKGRQSKVLK------------MMEVPYVDRNTCRLSTSFSITQNMFCA-GYDAKQEDAC 413

  Fly   291 QGDSGGPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWI----KAVLRP 345
            ||||||| .||....:.::.||.::| :.|.:.|..||||:.:|||.||    ||.:.|
  Rat   414 QGDSGGP-HVTRFKDTYFVTGIVSWG-EGCARKGKYGIYTKVTAFLKWIDRSMKARVGP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 86/269 (32%)
Tryp_SPc 90..342 CDD:238113 88/274 (32%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 87/270 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.