DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG18420

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:262 Identity:79/262 - (30%)
Similarity:119/262 - (45%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152
            |:|.|..|..|..||||   :|:|::.:.:  |.|:||:.|.|||:|||.  ||....:  ||||
  Fly    42 RIVNGKVAVRNSSPWMA---FLHTSSNQFI--CGGTLISRRLVLTAAHCF--IPNTTIV--VRLG 97

  Fly   153 EHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTG 217
            |        ||...:....       |.::.:...|..:...::.|   |||||||...|.|:..
  Fly    98 E--------YNRKLKGYRE-------EHQVNRTFQHRFYDPNTHAN---DIALLRLVSNVVYKAN 144

  Fly   218 IMPICIP-----KHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL 277
            |.||||.     ||...:...|...|||:|.....|..|....|..:...:||.....     |.
  Fly   145 IRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMCAFGSVL-----SN 204

  Fly   278 QICAGGYDGVDTCQGDSGGPL--MVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340
            |.|||.::. :.|.||:|||:  ||...|:..::.......:|.|.:   |.::|...:.:.:|:
  Fly   205 QFCAGNWNS-NLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQR---PSVFTDVMSHIEFIR 265

  Fly   341 AV 342
            .:
  Fly   266 RI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 78/257 (30%)
Tryp_SPc 90..342 CDD:238113 78/258 (30%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 78/257 (30%)
Tryp_SPc 43..267 CDD:238113 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.