DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG33462

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:303 Identity:97/303 - (32%)
Similarity:132/303 - (43%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ICC---PPPGNRLPSTEICG--QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILP---FCA 121
            |||   ...|.::...|.||  .::|. |.|....|:   .||||   ||.|      |   .|:
  Fly    11 ICCLWRRVQGFQMLLEEDCGIPHNISE-RSVNAKLAQ---NPWMA---YLET------PKGFHCS 62

  Fly   122 GSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQ-CALPNLEIKLEKI 185
            |:|||:.:|||:||||   |.|| |.:|||||    |:.....||   ||. |..|..|..::..
  Fly    63 GTLINHLFVLTAAHCV---PDDL-LITVRLGE----YNTKTKVDC---DNHLCQEPFQEYNVDMG 116

  Fly   186 IVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLE----------IAGWG 240
            ..|..:::....|   ||.:|||...|.|...|.||||     ||.::.:          ...|.
  Fly   117 FRHRYYNANDQTN---DIGMLRLGRRVEYLNHIRPICI-----FASNRFQEPIDQLTWFTTTVWR 173

  Fly   241 KTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSL-QICAGGYDGVDTCQGDSGGPLMVTM-- 302
            :|.....|:||....|..:....|:..:.:   |.:. |||||.... ..|..|||.|.:..|  
  Fly   174 ETAANATSKVLRTMNIDRQPKETCSEIYGW---NMTFEQICAGNTLS-QLCSTDSGAPQIRKMWH 234

  Fly   303 DNSSVYL-AGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344
            :.|..|: .||   .|:..||....||.....::..|||.|:|
  Fly   235 NGSDRYVQLGI---ASRVKGQCQNSGILMDLLSYADWIKRVVR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 84/268 (31%)
Tryp_SPc 90..342 CDD:238113 86/269 (32%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 84/258 (33%)
Tryp_SPc 48..269 CDD:214473 81/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.