DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG33461

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:282 Identity:97/282 - (34%)
Similarity:138/282 - (48%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EICG--QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGI 140
            |.||  ..|| |:::.|:.||...|||||   :|:|.|..:   |||||||..:|||||||:.. 
  Fly    30 ENCGVVPRLS-YKIINGTPARLGRYPWMA---FLHTPTYFL---CAGSLINQWFVLTSAHCIED- 86

  Fly   141 PRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIAL 205
              |:.| ..||||::...|    .||  ::|:|.....|..::.:..|.|:..   ::...||.:
  Fly    87 --DVEL-IARLGENNRDND----IDC--ENNRCLEATQEYNVDMLFKHRLYDP---KDFSNDIGM 139

  Fly   206 LRLKMPVRYRTGIMPICIPKHGFFAKSKLEI--------AGWGKTN---EGQFSQVLMHGFIRER 259
            |||:..|.|...|.||||..|   .:.:|.:        .|||.|:   ..:.|:|||...:..|
  Fly   140 LRLERRVEYTYHIQPICIFHH---RRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRR 201

  Fly   260 SIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGP---LMVTMDNSSVYLAGITTYGSKNCG 321
            ....||..|....|  |.|||||..|| :.|:||||||   .::..........||.::..:||.
  Fly   202 PRNDCARIFKQNFL--SGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCS 263

  Fly   322 QIGIPGIYTRTSAFLPWIKAVL 343
            ::   .|.|....:..|||.|:
  Fly   264 KV---SILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 87/264 (33%)
Tryp_SPc 90..342 CDD:238113 90/265 (34%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 87/264 (33%)
Tryp_SPc 42..281 CDD:238113 90/266 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.