DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and Sp212

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:301 Identity:86/301 - (28%)
Similarity:136/301 - (45%) Gaps:59/301 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PPPGNRLP----STEICGQSLSTYR-MVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINN 127
            |||....|    |:.:||:..||.. :|.|:|.....|||::.:.:.....|...  |.||||::
  Fly   251 PPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFK--CRGSLISS 313

  Fly   128 RYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFS 192
            ..|:::||||:.:..|..:  |.||.:|:   ..|..|..:..|          :.:::.|..::
  Fly   314 SIVISAAHCVHRMTEDRVV--VGLGRYDL---DDYGEDGAEMRN----------VMRLLWHPDYN 363

  Fly   193 SISNRNIEYDIALLRLKMPVRYRTGIMPIC---------IPKHGFFAKSKLEIAGWGKTNEG--- 245
            :.|..  :.||||:.::.||.:...|.|||         :...||       |||||:..:.   
  Fly   364 TRSYS--DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF-------IAGWGRDEDSSRT 419

  Fly   246 QFSQVLMHGFIRERSIA---VCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV 307
            |:.:|:      |..||   |||..:....:.:. .:|||..||...|.|||||.|||...:..:
  Fly   420 QYPRVV------EAEIASPTVCASTWRGTMVTER-SLCAGNRDGSGPCVGDSGGGLMVKQGDRWL 477

  Fly   308 YLAGITTYGSK----NCGQIGIPGIYTRTSAFLPWIKAVLR 344
             |.||.:.|.:    .| |:....:|...|..:.||...:|
  Fly   478 -LRGIVSAGERGPAGTC-QLNQYVLYCDLSKHINWISENIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 74/270 (27%)
Tryp_SPc 90..342 CDD:238113 76/270 (28%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 76/271 (28%)
Tryp_SPc 277..511 CDD:214473 74/268 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.