DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG30286

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:80/257 - (31%)
Similarity:128/257 - (49%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPD 165
            ||||   ||:.:. |::  |.|:|:|:|::||:|||:.   .|.:| :|||||    ::...:.|
  Fly    47 PWMA---YLHKSG-ELV--CGGTLVNHRFILTAAHCIR---EDENL-TVRLGE----FNSLTSID 97

  Fly   166 CRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI------- 223
            |...|  |..|:.:.:::....||   ..|..|..:||.||||...|.|:..|.|||:       
  Fly    98 CNGSD--CLPPSEDFEIDVAFRHG---GYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQ 157

  Fly   224 PK----HGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGY 284
            ||    |      :|...|||::.....:.:|....:...:..||:..: ::|..:. |||....
  Fly   158 PKIERLH------RLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTY-WVDRRRD-QICVSHE 214

  Fly   285 DGVDTCQGDSGGPL--MVTMDNSSVYL-AGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343
            .|| :|.||||||:  .:.:|...::: .||.:||:..|..   |.::|.....:.||.|.|
  Fly   215 SGV-SCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS---PSVFTNVMEHIDWIMAAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 76/251 (30%)
Tryp_SPc 90..342 CDD:238113 78/254 (31%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 77/252 (31%)
Tryp_SPc 39..268 CDD:214473 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.