DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG30187

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:282 Identity:88/282 - (31%)
Similarity:123/282 - (43%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPR 142
            :|||.::: .::.||..|......|||.:  .|.|..    .|.|:||:.|:|||:|||:    .
  Fly    26 QICGINIA-LKITGGHNAAFQNSVWMAAV--HNRTHF----ICGGTLIHKRFVLTAAHCI----V 79

  Fly   143 DLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLR 207
            |..::||.||.::.: |||...|                :...:||..|.  ...:.|.||.||:
  Fly    80 DQDVQSVSLGAYNKS-DPADRKD----------------VITAVVHSSFD--VRASYENDIGLLK 125

  Fly   208 LKMPVRYRTGIMPICIPKHGFFAK-----SKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALR 267
            |...|.:...|.||||..:...|.     ...:..|||.....:.|.:|....:.......|   
  Fly   126 LSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREEC--- 187

  Fly   268 FPYLDLN---QSLQICAGGYDGVDTCQGDSGGPLMVTMD-------NSSVYLAGITTYGSKNC-G 321
              |::|:   ...|||||...| |||.|||||||  |.|       |..|.. ||.:.|..:| |
  Fly   188 --YMELSVYPSEKQICAGVPSG-DTCGGDSGGPL--TNDVFIQGIGNREVQF-GIISVGKTSCDG 246

  Fly   322 QIGIPGIYTRTSAFLPWIKAVL 343
            |    |:||...:|..|||..:
  Fly   247 Q----GVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 82/266 (31%)
Tryp_SPc 90..342 CDD:238113 85/267 (32%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 82/266 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.