DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG30088

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:278 Identity:96/278 - (34%)
Similarity:140/278 - (50%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVN 138
            :||..:..:|....|:|.|.||.....|:||.|.|    :.||  .|.|::|::||:||:|||:.
  Fly    30 IPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYY----SSEI--HCGGTIISSRYILTAAHCMR 88

  Fly   139 GIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDI 203
            ..     || |||||||||    .||||  |...|:.|..|..:.....:..|    :|.:..||
  Fly    89 PY-----LK-VRLGEHDIT----RNPDC--QGGSCSPPAEEFDIVLATKYKRF----DRFLANDI 137

  Fly   204 ALLRLKMPVRYRTGIMPICIPKHGFFAKS--KLEIAGWGKTNEGQFSQVLMHGFIRERSIAVC-- 264
            |||:|...:|:...|.|||:..:...|.:  :.:..|||:|.....:.||....:.......|  
  Fly   138 ALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRS 202

  Fly   265 ALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV--YL-AGITTYGSKNCGQIGIP 326
            .|..| :.:|   |:|. |:.|.|||.|||||||:..::...|  || .||.::|...|..   |
  Fly   203 VLSMP-ITIN---QLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS---P 259

  Fly   327 GIYTRTSAFLPWIKAVLR 344
            |:||....::.||:.|::
  Fly   260 GVYTYVPNYIRWIRYVMQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 90/257 (35%)
Tryp_SPc 90..342 CDD:238113 91/258 (35%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 90/257 (35%)
Tryp_SPc 45..273 CDD:238113 90/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.