DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG30087

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:98/274 - (35%)
Similarity:147/274 - (53%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ICG---QSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGI 140
            :||   :|.:..|:|.|.||.....|:|   :|:...:   |..|.||::|:||:||:||||  .
  Fly    29 LCGVTYESQTAMRVVNGKEAVIRSAPFM---VYVTNNS---LTHCGGSILNSRYILTAAHCV--F 85

  Fly   141 PRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIAL 205
            |   :|: :|||||:|..|    |||  |.:.|:..:.|..:.|.|.|..:::.::.|   ||||
  Fly    86 P---NLR-LRLGEHNIRTD----PDC--QGSNCSPRSEEYGIMKAITHRFYNAANHVN---DIAL 137

  Fly   206 LRLKMPVRYRTGIMPICIPKHGFFAKS--KLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRF 268
            |:|...:.:...|.||||..:...|.|  ..:..|||:|.:..|..:|....:|....|.|:..|
  Fly   138 LKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSF 202

  Fly   269 -PYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV--YL-AGITTYGSKNCGQIGIPGIY 329
             .|::.|   |||| |::..|||.|||||||:..:|...|  || .||.:||..:|..   ||:|
  Fly   203 HAYMNGN---QICA-GHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS---PGVY 260

  Fly   330 TRTSAFLPWIKAVL 343
            |....::.||:..:
  Fly   261 TYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 93/256 (36%)
Tryp_SPc 90..342 CDD:238113 94/257 (37%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 93/256 (36%)
Tryp_SPc 42..272 CDD:238113 94/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.