DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and F25E5.3

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_504915.1 Gene:F25E5.3 / 184925 WormBaseID:WBGene00017784 Length:377 Species:Caenorhabditis elegans


Alignment Length:314 Identity:54/314 - (17%)
Similarity:88/314 - (28%) Gaps:143/314 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RLPSTE------ICGQSLSTYRMVGGSEARPNGYPW---------------------MAMLLYLN 110
            ||.|||      .||:: :.|:|......|....||                     :..|:.||
 Worm    27 RLNSTENKQLQATCGRN-TRYQMKTLDGERSIESPWAGSVNIYGILSSTVISPRHILLFNLIQLN 90

  Fly   111 TTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDIT-----------YDPAYN- 163
            ..||::      |::|...:...:.|.         ||..|..|.|.           .|.||. 
 Worm    91 VDTLKM------SILNETVIAQESKCD---------KSDLLLPHQINDWFQVDFVAKQMDKAYKH 140

  Fly   164 -------PDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPI 221
                   ..|.:.|.                             |...::.|:..:.:.......
 Worm   141 VQRIYTIDGCDELDT-----------------------------YKPMIIELEYDMWFDKAHGAA 176

  Fly   222 CIPKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSI--------AVCALRFPYLDLNQSLQ 278
            |:||                        .:.|..|:|.::        |:.:.|:       :.:
 Worm   177 CLPK------------------------PISHSDIQEFTVFGLGPNETALTSTRY-------AKE 210

  Fly   279 ICAGGYDGVDT------------CQGDSGGPLMVTMDNSSVYLAGITTYGSKNC 320
            .|...:.|...            |.||.|...:.|:|..:|.| ||...|:.:|
 Worm   211 ACEREHAGNSVFCGRPLKGNRRLCAGDFGAGAVATIDGRNVVL-GIYAEGNTDC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 46/293 (16%)
Tryp_SPc 90..342 CDD:238113 45/291 (15%)
F25E5.3NP_504915.1 DUF316 7..292 CDD:252150 54/314 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.