DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and F25E5.4

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:271 Identity:73/271 - (26%)
Similarity:103/271 - (38%) Gaps:70/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CGQSLSTYRMVGGSEARPNGYPWMAMLLYL--NTTTLEILPFCAGSLINNRYVLT--SAHCVNGI 140
            ||...|....:.|..|||..:|| |:.:|:  |||:...:....|:||:.|:|||  |...|:|.
 Worm    32 CGIKGSQREFINGDTARPGDHPW-AVSVYVKANTTSKNGVFLGPGTLISARHVLTFNSIKVVDGK 95

  Fly   141 PRDLSLKSVR---LGEH-DITYDPAYNPDC-----------RDQDNQCALPNLEIKLEKIIVHGL 190
            .|.|..:.|.   .|.| :::.|..|:.|.           ||..|..|        ...|::|.
 Worm    96 RRILGQEEVNGACNGNHFELSQDEMYHFDYDFEHFKNFDSKRDFKNTIA--------SVYIINGC 152

  Fly   191 FSSISNRNIEYDIALLRLKMPVRYRTGIMPICI---PKHGFFAKSKLEIAG---WGKTNEGQFSQ 249
            .||.....    :.:..||....:.....|:||   |||  |..|..|:.|   .|:...|.|:.
 Worm   153 QSSPPPAT----LLMFELKESALHNKKGYPVCISNSPKH--FDASDFEVFGLNQQGRLVSGAFAP 211

  Fly   250 VLMHGFIRERSIAVCALRFPY-----LDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYL 309
                        ..|....|:     :..||.|            |.||.||..:..:||....|
 Worm   212 ------------TNCTATAPFSCAHAVKQNQGL------------CSGDFGGSAVSRIDNRFTML 252

  Fly   310 AGITTYGSKNC 320
             |....|:|||
 Worm   253 -GFFAQGNKNC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 70/263 (27%)
Tryp_SPc 90..342 CDD:238113 70/261 (27%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 73/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12419
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.