DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31219 and CG43742

DIOPT Version :9

Sequence 1:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:277 Identity:100/277 - (36%)
Similarity:130/277 - (46%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVR 150
            |||:..|..|..:.:  || .||.|:..     ||.||||:.:||||:||||    |||...:|.
  Fly    32 TYRVANGHTAITSQF--MA-ALYNNSEF-----FCGGSLIHKQYVLTAAHCV----RDLDEVTVH 84

  Fly   151 LGEHDITYDPAYNPDCRDQDNQCALPNLEIKLE---KIIVHGLFSSISNRNIEYDIALLRLKMPV 212
            |||:               :..|.:|..:..|.   |:|:|..|......|   |||||||:..|
  Fly    85 LGEN---------------NRSCPIPVCKHVLRLNAKVILHPNFHGNIFLN---DIALLRLEREV 131

  Fly   213 RYRTGIMPICI---------PKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRF 268
            .:...|.||||         .::.|.|      .|||||..|..|.||  .||.       .:|.
  Fly   132 IFEAHIRPICIILDEDVTSNNQNNFTA------YGWGKTEHGNISDVL--SFID-------LVRL 181

  Fly   269 P----YLDLNQSLQICAGGYDGVDTCQGDSGGPLM---VTMDNSSVYLAGITTYGSKNCGQIGIP 326
            |    |.::|   .||||...| |||:.||||||:   |....|...|.|||:||...|.  |:.
  Fly   182 PKSMCYQNIN---TICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECS--GLF 240

  Fly   327 GIYTRTSAFLPWIKAVL 343
            |:||..:|:..||.:|:
  Fly   241 GVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 95/269 (35%)
Tryp_SPc 90..342 CDD:238113 96/270 (36%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 95/269 (35%)
Tryp_SPc 35..256 CDD:238113 96/271 (35%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.